MAKE A MEME
View Large Image
| View Original: | Chlorotabanus_crepuscularis,_Green_Horse_Fly,_Duck,_nc_2016-01-07-14.30.jpg (5760x3840) | |||
| Download: | Original | Medium | Small | Thumb |
| Courtesy of: | www.flickr.com | More Like This | ||
| Keywords: north carolina northcarolina sam droege samdroege ashleigh jacobs ashleigh ashleighjacobsashleigh jacobs chlorotabanus jacobschlorotabanus crepuscular taxonomy:binomial=chlorotabanus crepusculartaxonomybinomialchlorotabanus crepuscular fly flies insect arthropod animal eyes compound crepuscularflyfliesinsectarthropodanimaleyescompound eyes close up macro intense svelte slim fast swift pwrc eyescloseupmacrointensesvelteslimfastswiftpwrc patuxent wildlife research center usgs pollinator animals black background photo border pattern organic pattern A beautiful pale white and green horse fly from North Carolina, Chlorotabanus crepuscular, a drinker of blood that comes out only at dawn and dusk, this is a southern species I had not seen before. This specimen was collected in Duck, North Carolina by Lisa Kuder. Picture taken by Ashleigh Jacobs. ~~~~~~~~~~{{{{{{0}}}}}}~~~~~~~~~~ All photographs are public domain, feel free to download and use as you wish. Photography Information: Canon Mark II 5D, Zerene Stacker, Stackshot Sled, 65mm Canon MP-E 1-5X macro lens, Twin Macro Flash in Styrofoam Cooler, F5.0, ISO 100, Shutter Speed 200 Beauty is truth, truth beauty - that is all Ye know on earth and all ye need to know " Ode on a Grecian Urn" John Keats You can also follow us on Instagram account USGSBIML Want some Useful Links to the Techniques We Use? Well now here you go Citizen: Art Photo Book: Bees: An Up-Close Look at Pollinators Around the World www.qbookshop.com/products/216627/9780760347386/Bees.html... Basic USGSBIML set up: www.youtube.com/watch?v=S-_yvIsucOY USGSBIML Photoshopping Technique: Note that we now have added using the burn tool at 50% opacity set to shadows to clean up the halos that bleed into the black background from "hot" color sections of the picture. www.youtube.com/watch?v=Bdmx_8zqvN4 PDF of Basic USGSBIML Photography Set Up: ftp://ftpext.usgs.gov/pub/er/md/laurel/Droege/How%20to%20Take%20MacroPhotographs%20of%20Insects%20BIML%20Lab2.pdf Google Hangout Demonstration of Techniques: plus.google.com/events/c5569losvskrv2nu606ltof8odo or www.youtube.com/watch?v=4c15neFttoU Excellent Technical Form on Stacking: www.photomacrography.net/ Contact information: Sam Droege sdroege@usgs.gov 301 497 5840 A beautiful pale white and green horse fly from North Carolina, Chlorotabanus crepuscular, a drinker of blood that comes out only at dawn and dusk, this is a southern species I had not seen before. This specimen was collected in Duck, North Carolina by Lisa Kuder. Picture taken by Ashleigh Jacobs. ~~~~~~~~~~{{{{{{0}}}}}}~~~~~~~~~~ All photographs are public domain, feel free to download and use as you wish. Photography Information: Canon Mark II 5D, Zerene Stacker, Stackshot Sled, 65mm Canon MP-E 1-5X macro lens, Twin Macro Flash in Styrofoam Cooler, F5.0, ISO 100, Shutter Speed 200 Beauty is truth, truth beauty - that is all Ye know on earth and all ye need to know " Ode on a Grecian Urn" John Keats You can also follow us on Instagram account USGSBIML Want some Useful Links to the Techniques We Use? Well now here you go Citizen: Art Photo Book: Bees: An Up-Close Look at Pollinators Around the World www.qbookshop.com/products/216627/9780760347386/Bees.html... Basic USGSBIML set up: www.youtube.com/watch?v=S-_yvIsucOY USGSBIML Photoshopping Technique: Note that we now have added using the burn tool at 50% opacity set to shadows to clean up the halos that bleed into the black background from "hot" color sections of the picture. www.youtube.com/watch?v=Bdmx_8zqvN4 PDF of Basic USGSBIML Photography Set Up: ftp://ftpext.usgs.gov/pub/er/md/laurel/Droege/How%20to%20Take%20MacroPhotographs%20of%20Insects%20BIML%20Lab2.pdf Google Hangout Demonstration of Techniques: plus.google.com/events/c5569losvskrv2nu606ltof8odo or www.youtube.com/watch?v=4c15neFttoU Excellent Technical Form on Stacking: www.photomacrography.net/ Contact information: Sam Droege sdroege@usgs.gov 301 497 5840 | ||||
